PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100276730021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family NAC
Protein Properties Length: 253aa    MW: 28045.9 Da    PI: 6.2423
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100276730021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.53.8e-51251511128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratks 80 
                                   + pGfrF+Ptdeel+++yLk+k++g++  + evi+evdi+++ePwdLp ++v ++++ew+fFs+r +ky++g++++rat s
  Ote100276730021|100276730021  25 MFPGFRFSPTDEELIQYYLKRKLQGSHEGV-EVIPEVDICRHEPWDLPgESVIQSDSEWFFFSPRGRKYPNGSQSKRATVS 104
                                   579************************888.99***************767777899************************ PP

                           NAM  81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   gyWkatgk+++v+s +++l+g+k+tLvf++grapkg++t+W+mhey+ 
  Ote100276730021|100276730021 105 GYWKATGKERSVKS-GSTLIGTKRTLVFHTGRAPKGKRTEWIMHEYTT 151
                                   **************.99*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-5618166IPR003441NAC domain
PROSITE profilePS5100554.23725167IPR003441NAC domain
PfamPF023656.1E-2727150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MGHDERARSG INIPMEISIA EASSMFPGFR FSPTDEELIQ YYLKRKLQGS HEGVEVIPEV  60
DICRHEPWDL PGESVIQSDS EWFFFSPRGR KYPNGSQSKR ATVSGYWKAT GKERSVKSGS  120
TLIGTKRTLV FHTGRAPKGK RTEWIMHEYT TTDKSEDAMV VCRLRKNREF QLNDDPTRDS  180
PGERGFLAVD NSTPALSGVE QSGLLNAGSC SKDCSSSHNS HSVEQIDSGS GSASESDEKV  240
TNESSHHASN LNE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-452416816166NO APICAL MERISTEM PROTEIN
1ut4_B8e-452416816166NO APICAL MERISTEM PROTEIN
1ut7_A8e-452416816166NO APICAL MERISTEM PROTEIN
1ut7_B8e-452416816166NO APICAL MERISTEM PROTEIN
3swm_A9e-452416819169NAC domain-containing protein 19
3swm_B9e-452416819169NAC domain-containing protein 19
3swm_C9e-452416819169NAC domain-containing protein 19
3swm_D9e-452416819169NAC domain-containing protein 19
3swp_A9e-452416819169NAC domain-containing protein 19
3swp_B9e-452416819169NAC domain-containing protein 19
3swp_C9e-452416819169NAC domain-containing protein 19
3swp_D9e-452416819169NAC domain-containing protein 19
4dul_A8e-452416816166NAC domain-containing protein 19
4dul_B8e-452416816166NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088938.11e-124PREDICTED: NAC domain-containing protein 89-like
SwissprotQ94F584e-76NAC89_ARATH; NAC domain-containing protein 89
TrEMBLA0A022QFK11e-115A0A022QFK1_ERYGU; Uncharacterized protein
STRINGSolyc06g074170.2.11e-105(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243